Exenatide: what the trials show, status and safety
Summary
Exenatide is a lab-made copy of a peptide found in the venom of the Gila monster, a lizard of the American south-west. It has been a prescription-only medicine since 2005, and it was the first of the GLP-1 family to reach the market. In its largest trial, 14,752 adults with type 2 diabetes were followed for about three years. Serious heart events were slightly less common, but the difference was too small to rule out chance (p = 0.06). Newer relatives beat it in every head-to-head trial on this page, and a trial of 194 people found no effect on Parkinson's disease.
Key findings at a glance
- The first of its kind, approved on 28 April 2005. American regulators cleared it as an entirely new active substance, ahead of every other medicine that works on the same docking point [1], [2].
- A heart trial of 14,752 adults that fell just short. Serious heart events struck 11.4 percent against 12.2 percent on a dummy treatment. The gap was too small to rule out chance (p = 0.06) [3].
- Beaten by semaglutide in the one trial that compared them. Over 56 weeks in 813 adults, blood sugar fell by 0.9 percent against 1.5 percent, and weight by 1.9 kg against 5.6 kg [4].
- No effect in Parkinson's disease. A trial in 194 people ran for 96 weeks. The difference on the movement scale was 0.92 points, which is nothing (95 percent range −1.56 to 3.39, p = 0.47) [5].
- Far more people make antibodies against it than against the newer drugs. With the depot form, 40.2 percent developed low levels and 33.8 percent high levels at some point [6].
- Three American safety notices in three years. Regulators reported 30 cases of pancreas inflammation in 2007, six severe cases in 2008, and 78 cases of altered kidney function in 2009 [7], [8], [9].
- Discontinued is not withdrawn. The originator's American products are listed as discontinued, yet a generic version was approved on 19 November 2024 and reached the market three days later [10], [11].
What it is
Exenatide is a peptide of 39 building blocks that switches on the docking point of the gut hormone GLP-1. It is made entirely in a factory. Its sequence copies exendin-4, a peptide isolated in 1992 from the venom of the Gila monster, a lizard of the American south-west [2], [12].
It is not lizard venom, and no animal material goes into it. The American package insert calls it a synthetic peptide that was originally identified in that lizard [2]. It is also not a copy of human GLP-1. It is a separate peptide that happens to fit the same receptor.
Amylin Pharmaceuticals and Eli Lilly developed it, and AstraZeneca has held the rights since 2014. Two brands carried it: Byetta, a clear solution that releases the peptide at once, and Bydureon, a suspension of the same peptide inside slowly dissolving beads [2], [6].
Quick facts
| Field | Value | Ref |
|---|---|---|
| INN | exenatide | [2] |
| Development codes | AC2993, LY2148568, PT302 | [13] |
| Class | Switches on the docking point of the gut hormone GLP-1 | [2] |
| Structure | 39 building blocks, with an amide cap at the tail end | [2] |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 | [2] |
| Formula and mass | C184H282N50O60S, 4,186.6 Da | [2], [13] |
| How long it lasts | About 2.4 hours in the immediate-release form, meaning the time the blood needs to clear half of it (half-life) | [2] |
| How it is taken | Injected under the skin | [2] |
| Status | Prescription-only in every market that has ever carried it | [1], [14], [15] |
| Developer | Amylin Pharmaceuticals with Eli Lilly; now AstraZeneca AB | [2], [1] |
| ATC code | A10BJ01; the older record A10BX04 also appears | [13], [16] |
| CAS registry number | 141758-74-9 | [13] |
| UNII | 9P1872D4OL | [13] |
| PubChem CID | 45588096 | [13] |
| InChIKey | HTQBXNHDCUEHJF-XWLPCZSASA-N | [13] |
| DrugBank | DB01276 | [16] |
| ChEMBL | CHEMBL414357 | [16] |
| MeSH | D000077270 | [16] |
| KEGG | D04121 | [16] |
How it works
The approved package insert sets out the mechanism, because it was assessed alongside the trials [2].
- The GLP-1 docking point. Exenatide attaches to the receptor for the gut hormone GLP-1 and switches it on, as the natural hormone does [2].
- Insulin, but only when needed. In the insulin-producing cells of the pancreas the switch works through a messenger molecule called cyclic AMP. Insulin comes out only while blood sugar is actually high [2].
- Less of the opposing hormone. Glucagon, which pushes blood sugar up, is released in smaller amounts when it should not be [2].
- The stomach empties more slowly, which flattens the rise in blood sugar after a meal [2].
- What the body does with it. It is filtered out by the kidneys and then broken apart, which is why kidney function matters so much here [2].
The two forms differ in packaging, not in molecule. The depot form holds unchanged exenatide inside beads of a dissolvable polymer, which release it gradually. Levels rise for about ten weeks, then hold steady, and take about another ten weeks to disappear after the last injection [6].
Its relatives took a different route to lasting longer. Liraglutide and semaglutide are altered copies of the human hormone itself, which stay in the blood for hours or days without any depot [17], [4].
What the trials found
The heart
Phase 3 RCT, built to show a difference The heart trial enrolled 14,752 adults with type 2 diabetes and any level of heart risk. Their average age was 62, they had had diabetes for 13.1 years on average, and 73.1 percent already had heart disease [3].
They were followed for a median of 3.2 years, meaning the middle value of the follow-up times (range 2.2 to 4.4). A serious heart event struck 839 of 7,356 treated people, or 11.4 percent, against 905 of 7,396, or 12.2 percent [3].
That works out at 3.7 events per 100 person-years against 4.0, and at 9 percent less risk (hazard ratio 0.91). The range around it runs from 17 percent less to no difference at all (0.83 to 1.00) [3].
Late-stage trial in 14,752 adults with type 2 diabetes. Non-inferiority was met (p < 0.001), superiority was missed (p = 0.06), hazard ratio 0.91 with a 95 percent range of 0.83 to 1.00. Source [3].
The trial therefore did two different things at once. It showed that exenatide was no worse than the dummy treatment, which it was designed to show first (p < 0.001). It failed to show that exenatide was better (p = 0.06) [3].
Deaths from any cause occurred in 507 treated people, or 6.9 percent, against 584, or 7.9 percent. Rates of heart death, heart attack, stroke, admission for heart failure, pancreas inflammation, pancreatic cancer and thyroid cancer showed no clear difference [3], [6].
This is why exenatide never gained a heart indication. Its American package insert names only the improvement of blood sugar control [6].
Blood sugar and weight
Phase 3 RCT Three placebo-controlled trials of 30 weeks underpinned the original approval. Added to metformin in 336 adults, long-term blood sugar fell by 0.78 ± 0.10 percent at the higher dose level and by 0.40 ± 0.11 percent at the lower one. On the dummy treatment it rose by 0.08 ± 0.10 percent (adjusted p < 0.002) [18].
Weight fell by 2.8 ± 0.5 kg and 1.6 ± 0.4 kg against the dummy treatment (p < 0.001). A value of 7 percent or below was reached by 46 percent, 32 percent and 13 percent of those assessed (p < 0.01) [18].
Phase 3 RCT Added to a sulfonylurea in 377 adults, blood sugar fell by 0.86 ± 0.11 percent and by 0.46 ± 0.12 percent. On the dummy treatment it rose by 0.12 ± 0.09 percent (adjusted p < 0.001). Weight fell by 1.6 ± 0.3 kg at the higher dose level (p < 0.05) [19].
Phase 3 RCT Added to both drugs at once in 733 adults, the falls were 0.8 ± 0.1 and 0.6 ± 0.1 percent. On the dummy treatment blood sugar rose by 0.2 ± 0.1 percent (adjusted p < 0.0001). Weight fell by 1.6 ± 0.2 kg in both treated groups against 0.9 ± 0.2 kg [20].
Low blood sugar tracked the companion drug rather than exenatide. With a sulfonylurea it affected 28 percent, 19 percent and 13 percent of participants [20].
The depot form against the original
Phase 3 RCT, open In 295 adults over 30 weeks, the depot form lowered long-term blood sugar by 1.9 percent (standard error 0.1) against 1.5 percent (0.1) for the immediate-release solution. The difference favoured the depot (95 percent range −0.54 to −0.12, p = 0.0023) [21].
A value of 7.0 percent or below was reached by 77 percent against 61 percent (p = 0.0039). Weight loss was similar in both groups, and low blood sugar was no more frequent [21]. The registry records 303 participants for this trial and the paper 295; the difference has not been resolved [22].
Against liraglutide
Phase 3 RCT, open In 912 adults over 26 weeks, blood sugar fell by 1.48 percent (standard error 0.05) on liraglutide against 1.28 percent (0.05) on the depot form. The gap of 0.21 percent (95 percent range 0.08 to 0.33) missed the pre-set bar for calling the two equivalent [23].
Tolerance ran the other way. Feeling sick affected 93 people, or 21 percent, against 43, or 9 percent; diarrhoea 59, or 13 percent, against 28, or 6 percent; vomiting 48, or 11 percent, against 17, or 4 percent [23].
Phase 3 RCT, open An earlier trial in 464 adults over 26 weeks compared liraglutide with the immediate-release solution. Blood sugar fell by 1.12 percent (standard error 0.08) against 0.79 percent (0.08), a difference of 0.33 percent (95 percent range −0.47 to −0.18, p < 0.0001) [17].
A value below 7 percent was reached by 54 percent against 43 percent (odds ratio 2.02, range 1.31 to 3.11, p = 0.0015). Weight loss was similar, at 3.24 kg against 2.87 kg [17].
Against semaglutide
Phase 3a RCT, open In 813 adults over 56 weeks, blood sugar fell by 1.5 percent on semaglutide against 0.9 percent on the depot form. The difference was 0.62 percent (95 percent range −0.80 to −0.44, p < 0.0001) [4].
Weight fell by 5.6 kg against 1.9 kg, a difference of 3.78 kg (95 percent range −4.58 to −2.98, p < 0.0001). A value below 7.0 percent was reached by 67 percent against 40 percent [4].
Side effects split by type. Stomach and bowel complaints were commoner on semaglutide, at 41.8 percent against 33.3 percent. Reactions where the needle went in were far commoner on the depot, at 22.0 percent against 1.2 percent [4].
Combined with dapagliflozin
Phase 3 RCT, double-blind In 695 adults over 28 weeks, the combination lowered blood sugar by 2.0 percent (95 percent range −2.1 to −1.8). Exenatide alone managed 1.6 percent and dapagliflozin alone 1.4 percent [24].
The combination beat both single drugs, by 0.4 percent (range −0.6 to −0.1, p = 0.004) and 0.6 percent (−0.8 to −0.3, p < 0.001). No episodes of low blood sugar were reported at all [24].
Parkinson's disease
Phase 2 RCT A single-centre trial randomised 62 people with Parkinson's disease. After 60 weeks the movement score had improved by 1.0 point in the treated group (95 percent range −2.6 to 0.7). On the dummy treatment it had worsened by 2.1 points (−0.6 to 4.8) [25].
The adjusted difference of 3.5 points favoured exenatide (95 percent range −6.7 to −0.3, p = 0.0318). Six serious events occurred in the treated group and two on the dummy treatment, none of them judged to be related [25].
Phase 3 RCT The larger trial that followed randomised 194 people at six British centres and ran for 96 weeks. Of 215 people screened, 194 entered, and 92 treated and 96 untreated participants had at least one follow-up visit [5].
Both groups got worse, and by almost the same amount. The movement score deteriorated by 5.7 points (standard deviation 11.2) against 4.5 points (11.4). The adjusted coefficient was 0.92 (95 percent range −1.56 to 3.39, p = 0.47) [5].
Serious events affected nine people, or 9 percent, against eleven, or 11 percent. The authors conclude that exenatide is safe and well tolerated, and that there is no evidence it slows Parkinson's disease [5].
Weight in people without diabetes
Meta-analysis of six RCTs Six trials with 362 participants ran for 12 to 24 weeks. Pooled, weight was 4.47 kg lower than in the control groups (95 percent range −6.67 to −2.27, p < 0.0001) [26].
Body mass index was 0.86 kg/m2 lower (−1.39 to −0.33, p = 0.001) and waist circumference 1.78 cm smaller (−3.13 to −0.44, p = 0.009). Blood pressure and blood fats showed no clear benefit [26].
None of that was a licensing trial, and the authors themselves call for larger and longer ones. Exenatide holds no weight-loss licence in any market on this page [26], [14].
What is still unknown
- Whether it helps the heart at all. The one trial built to answer that question missed its mark by a hair (p = 0.06), and no other trial has taken it up [3].
- Whether any group with Parkinson's disease benefits. The phase 3 result was flat overall, and subgroups were not resolved [5].
- What the rodent thyroid tumours mean for people. The package insert states plainly that this is undetermined [6].
- Why the original brands were withdrawn from sale. No safety recall is on record, and no commercial explanation is documented either [10], [27].
- What is in grey-market exendin-4. No published analysis of such material was found for this substance [28].
Side effects and safety
Stomach and bowel complaints dominate, as they do across this family. The figures below come from three placebo-controlled trials of 30 weeks, with 963 people treated against 483 on a dummy treatment, as printed in the American labelling [2].
| Event | Exenatide | Placebo |
|---|---|---|
| Feeling sick | 44% | 18% |
| Vomiting | 13% | 4% |
| Diarrhoea | 13% | 6% |
| Feeling jittery | 9% | 4% |
| Dizziness | 9% | 6% |
| Headache | 9% | 6% |
| Indigestion | 6% | 3% |
| Weakness | 4% | 2% |
| Reflux | 3% | 1% |
| Sweating more | 3% | 1% |
Low blood sugar depends almost entirely on what else the person takes. Alone it affected 5.2 percent and 3.8 percent against 1.3 percent. With a sulfonylurea the rates were 14.4 percent and 35.7 percent against 3.3 percent, and with insulin glargine 24.8 percent against 29.5 percent [2].
Severe episodes were rare, at 0.0 percent in almost every group. One treated group reached 0.4 percent and one dummy group 0.8 percent [2]. With the depot form, lumps where the needle went in affected 10.5 percent and feeling sick 8.2 percent, in 526 people [6].
The framed warning applies to one form only. In America the depot carries a boxed warning about tumours of a particular thyroid cell, which it causes in rats at exposures comparable to those in people. Whether it does so in people is unknown [6].
The immediate-release solution carries no such box, because the rodent finding came from the depot [2]. European texts carry no framed warning for either form, and name allergy to the ingredients as the only bar [14], [29].
What the labels warn about. Inflammation of the pancreas, including fatal bleeding and tissue-destroying forms, tops the list. The labels state that treatment is stopped on suspicion and not resumed after a confirmed case [2], [6].
- Kidney damage, from raised creatinine to failure needing dialysis or transplant, reported after approval. The label advises against use in severe kidney impairment [2].
- Low blood sugar when combined with insulin or with drugs that squeeze insulin out of the pancreas, sometimes severe [2].
- Immune destruction of platelets caused by the drug, with antibodies that only attack when it is present. Fatal bleeding has been reported [2].
- Severe allergic reactions, including anaphylaxis and deep tissue swelling, reported after approval [2].
- Gallbladder disease, with investigation advised when gallstones or inflammation are suspected [14].
- Slowed stomach emptying can change how other tablets are absorbed. With warfarin, raised clotting values and bleeding have been reported [14].
- Not for type 1 diabetes and not for diabetic ketoacidosis, stated in both the European and the American texts [2], [14].
Antibodies are the distinctive problem. Antibody levels were measured in 90 percent of the participants in the 16, 24 and 30-week trials, and the average level peaked at week 6 before falling by 55 percent by week 30. At week 30, 360 people, or 38 percent, had low levels, and their blood sugar control matched that of the 534, or 56 percent, with none [2].
A further 59 people, or 6 percent, had higher levels. Of those, 32 responded less well and 27 responded normally, 3 percent of the whole group each way [2].
The depot form produced more. Of 393 people assessed, 40.2 percent developed low levels and about 33.8 percent high levels at some point, peaking around weeks 8 to 16 [6].
Immediate-release figures are from week 30 in 953 people; depot figures are the proportion positive at any point in 393 people. The two came from different assays at different times, and the labels say so. Sources [2], [6].
Reactions where the needle went in tracked those levels. They affected 15.7 percent of people without antibodies, 16.3 percent at low levels and 27.2 percent at high levels, 19.6 percent overall. One person of 118 with high levels made antibodies that also hit the body's own GLP-1 and glucagon; what that means is unknown [6].
Three regulatory notices in three years. In October 2007 American regulators reported 30 cases of acute pancreas inflammation after approval, 27 of them in people with another risk factor such as gallstones [7].
In August 2008 they added six cases of bleeding or tissue-destroying pancreas inflammation. All six were admitted to hospital, two died, and stronger warnings were put into the label [8].
In November 2009 they reported 78 cases of altered kidney function between April 2005 and October 2008, of which 62 were acute kidney failure. The label was changed again [9].
European frequency tables put feeling sick, vomiting, diarrhoea and low blood sugar with a sulfonylurea in the commonest band, at one person in ten or more. Gallbladder inflammation, gallstones and kidney changes sit in the uncommon band, and bowel obstruction and anaphylaxis in the rare one [14].
Why this page lists no doses
Exenatide is a prescription-only medicine in every market where it has ever been sold, and it remains on sale as a generic in the United States. Choosing an amount belongs to the approved product information and to the doctor writing the prescription. This page therefore refers to dose levels only as the lower or the higher tested level.
Development and approval status
Approval and evidence timeline
- 1992Exendin-4 is isolated from Gila monster venomPublished on 15 April, ref [12]
- 2005American approval on 28 April, as an entirely new active substanceThe first medicine of its class anywhere, ref [1]
- 2006European approval on 20 NovemberPrescription-only from the start, ref [30]
- 2011-2012The depot form is approvedEurope on 17 June 2011, America on 27 January 2012, refs [31], [32]
- 2017A depot autoinjector is approved in America on 20 OctoberSame substance, new device, ref [33]
- 2017The heart trial reports on 14 SeptemberNon-inferiority met, superiority missed, ref [3]
- 2022All four Canadian products are cancelledBetween 6 January and 30 May, ref [27]
- 2024An American generic is approved on 19 NovemberOn the market three days later, refs [10], [11]
- 2025The Parkinson trial reports no effectp = 0.47 over 96 weeks, ref [5]
- 1992 — the peptide is isolated from Gila monster venom and described on 15 April [12].
- 2005 — American approval on 28 April, as an entirely new active substance [1].
- 2006 — European approval on 20 November [30].
- 2010 and 2012 — Japanese approvals, on 27 October 2010 for the solution and 30 March 2012 for the depot [34].
- 2011 and 2012 — the depot form is approved in Europe on 17 June and in America on 27 January [31], [32].
- 2017 — an autoinjector version of the depot is approved in America on 20 October, and the heart trial reports [33], [3].
- 2022 — all four Canadian products are cancelled, between 6 January and 30 May [27].
- 2024 — an American generic is approved on 19 November and marketed from 22 November [10], [11].
- 2025 — the phase 3 Parkinson trial reports no effect [5].
| Market | Status | Date confirmed | Legal status |
|---|---|---|---|
| United States | Approved | 2005-04-28 | Prescription |
| European Union | Authorised | 2006-11-20 | Prescription |
| Germany | Authorised | 2006-11-20 | Prescription |
| United Kingdom | Not listed | 2026-09-10 | Not established |
| Australia | Scheduled | 2026-05-28 | Prescription |
| Canada | Cancelled | 2022-05-30 | Prescription |
| Switzerland | Not listed | 2026-09-10 | Not established |
| Japan | Approved | 2010-10-27 | Prescription |
Four entries need a word of explanation. The German date is the European one, because the licence is a European one; the substance is also named in the German prescription regulation by name [15].
The British and Swiss cells record searches that found nothing. The British medicines compendium returned no result on 10 September 2026, while a control search for dulaglutide worked [35]. The Swiss lists of authorised packs returned nothing either, with a control search again working [36].
Whether either country ever licensed it, or licensed it and let that lapse, could not be established from those lists. The Australian date is that of the current poisons instrument, which lists the substance as prescription-only without exception [37].
What discontinued means here. The American register lists the originator's three products as discontinued. That word marks the end of selling, not a withdrawal of the licence and not a safety recall [10].
Alongside them sits a generic application approved on 19 November 2024, rated as therapeutically equivalent and used as the reference standard. Its label was last updated on 27 May 2026 and carries the words prescription only [10], [11].
The European licences still read authorised, with no withdrawal or expiry noted [30], [31]. The Canadian products were cancelled in 2022, one of them before ever reaching the market [27].
Why any of that happened is not stated in any register examined. A commercial explanation is plausible but undocumented, so this page does not assert it [10], [27].
No legal route to a copy in America. Pharmacies may not copy a medicine that is approved and available. Exenatide is absent from the shortage database. It is absent from the list of substances allowed for compounding, and from the list of substances flagged as risky there [38], [39], [40].
The wider framework is set out under are peptides legal and FDA-approved peptides. Every entry in this section describes the position on 10 September 2026.
Anti-doping
Exenatide is not banned in sport. It appears nowhere on the 2026 prohibited list, in or out of competition. The full text of that list returns nothing for the substance or for exendin [41].
The control search worked, returning entries in the peptide-hormone class for growth factors and in the insulin class [41]. The German anti-doping annex does not name it either [42]. Whether the separate monitoring programme covers it was not checked, and nothing is claimed about that here.
None of this says anything about safety, and none of it changes medicines law, which applies regardless. The wider picture is at peptides banned in sport.
Compared with related peptides
| Peptide | Docking points | Compared with exenatide? | What that comparison showed |
|---|---|---|---|
| Exenatide | GLP-1 [2] | The reference here | Blood clears half of it in about 2.4 hours; the depot form lasts weeks [2], [6] |
| Liraglutide | GLP-1 [17] | Yes, twice, in 464 and 912 adults | Blood sugar 1.12% against 0.79%, p < 0.0001; the depot then missed equivalence by 0.21% [17], [23] |
| Semaglutide | GLP-1 [4] | Yes, in 813 adults over 56 weeks | Blood sugar 1.5% against 0.9%; weight 5.6 kg against 1.9 kg, both p < 0.0001 [4] |
| Dulaglutide | Not covered by the sources here | No trial on this page | Listed as prescription-only in the British register [35] |
| Tirzepatide | Not covered by the sources here | No trial on this page | Not measured against exenatide in any trial cited here |
Exenatide came first, and that is its distinction. Every head-to-head comparison on this page went against it, twice against liraglutide and once against semaglutide.
The chemistry explains part of it. Exenatide leaves the blood in about 2.4 hours, so the original solution held its levels for only a few hours [2]. Its successors were altered copies of the human hormone that hold on for a day or a week without any depot [17], [4].
The depot version solved the problem by packaging rather than chemistry, which brought its own costs: more lumps under the skin and far more antibodies [6], [4].
Common misconceptions
- "Exenatide and exendin-4 are different substances." They are the same peptide under two names. A registry search for either term returns exactly the same 378 trials. Grey-market sellers use the second name, which makes a prescription medicine look like a laboratory reagent [43], [13].
- "The two forms contain different drugs." They contain the same peptide. One is an immediate-release solution, the other the same molecule inside slowly dissolving beads. Both labels state that two exenatide products are not to be used together [2], [6].
- "It is lizard venom." The peptide was found in venom, but it is a hormone-like molecule, not a toxin, and the medicine is made synthetically. No animal material is involved [2], [12].
- "It is as strong as the newer drugs, only older." The head-to-head trials say otherwise: 0.9 percent against 1.5 percent on blood sugar and 1.9 kg against 5.6 kg on weight, against semaglutide [4], [23].
- "Discontinued means unsafe." It means selling stopped. A generic was approved in November 2024, the European licences still read authorised, and no safety recall appears in any register checked [10], [30], [27].
- "All drugs of this class protect the heart." Not as a class. The trial in 14,752 adults met its non-inferiority mark but missed superiority (hazard ratio 0.91, range 0.83 to 1.00, p = 0.06). Exenatide never gained a heart indication [3], [6].
- "It is an approved weight-loss drug." It is not, in any market examined. The licence covers type 2 diabetes only, and the weight changes in its trials were 1.6 to 2.8 kg over 30 weeks [14], [18].
- "The early Parkinson result proves it works." A trial of 62 people found a 3.5-point difference (p = 0.0318). A trial of 194 people found 0.92 points and no effect (p = 0.47) [25], [5].
- "A grey-market vial and a generic are both just the cheap version." A generic passes a licensing examination of identity, content, purity, sterility and equivalence. A powder sold for research passes none of it. Studies of this drug family found illegal online sellers in large numbers [10], [28].
Frequently asked questions
Is exenatide a prescription medicine?
Yes, in every market that has ever carried it. It is prescription-only in the United States, the European Union, Germany, Australia, Canada and Japan, and the German prescription regulation names it directly. Being sold as exendin-4 for research does not change that.
What is exenatide made from?
It is made synthetically, in a factory. Its sequence copies exendin-4, a peptide isolated in 1992 from the venom of the Gila monster, a lizard of the American south-west. No lizard material goes into the medicine, and the peptide itself is not a toxin.
Did exenatide reduce heart attacks and strokes?
Not clearly. In 14,752 adults with type 2 diabetes, serious heart events struck 11.4 percent against 12.2 percent on a dummy treatment. That is about 9 percent less risk (hazard ratio 0.91, range 0.83 to 1.00). That was enough to show it was no worse, but not enough to show it was better (p = 0.06).
How does exenatide compare with semaglutide?
Worse, in the one trial that compared them. Over 56 weeks in 813 adults, long-term blood sugar fell by 0.9 percent against 1.5 percent, and weight by 1.9 kg against 5.6 kg. Both differences favoured semaglutide at p < 0.0001.
Does exenatide help in Parkinson's disease?
No, on the evidence available. A small trial of 62 people found a 3.5-point advantage on the movement scale (p = 0.0318). A trial of 194 people over 96 weeks found a difference of 0.92 points (p = 0.47). Its authors state that there is no evidence of a disease-modifying effect.
What are the most common side effects of exenatide?
Feeling sick, vomiting and diarrhoea. In the placebo-controlled trials behind the approval, 44 percent felt sick against 18 percent, 13 percent vomited against 4 percent, and 13 percent had diarrhoea against 6 percent. Low blood sugar depends mostly on what else the person is taking.
Why does exenatide cause antibodies more often than newer drugs?
Because it is a lizard peptide rather than an altered copy of the human hormone, so the immune system treats it as foreign. In the original trials 38 percent of participants had low levels at week 30 and 6 percent higher levels, and with the depot form 33.8 percent reached high levels at some point. High levels went with more skin reactions and, in some people, less effect on blood sugar.
Is exenatide still available?
It depends on the market. The originator's brands are listed as discontinued in the United States and cancelled in Canada. An American generic was approved on 19 November 2024 and marketed from 22 November. The European licences still read authorised on 10 September 2026.
Why does this page list no exenatide doses?
Because exenatide is a prescription medicine wherever it has been sold, and choosing an amount belongs to the approved product information and to the prescribing doctor. This page refers to dose levels only as the lower or the higher tested level, and reports what was measured at each.
Is exenatide banned in sport?
No. It appears nowhere on the 2026 prohibited list of the World Anti-Doping Agency, in or out of competition, and the German anti-doping annex does not name it either. Nothing about safety or legality follows from that; it remains a prescription medicine.
Sources
- Drugs@FDA via openFDA — NDA 021773, approved 28 April 2005 as a type 1 new molecular entity, holder AstraZeneca AB, marketing status discontinued, latest labelling supplement 28 May 2025. https://api.fda.gov/drug/drugsfda.json?search=application_number:NDA021773 — queried 10 September 2026
- AstraZeneca (2021). BYETTA (exenatide) injection, for subcutaneous use — US Prescribing Information, revision 06/2021 (NDA 021773, SUPPL-45). Sections 1, 4, 5.1-5.8, 6.1, 6.2, 11, 12.1, 12.3 and 16.2. https://www.accessdata.fda.gov/drugsatfda_docs/label/2021/021773s045lbl.pdf
- Holman RR, Bethel MA, Mentz RJ et al. (2017). Effects of once-weekly exenatide on cardiovascular outcomes in type 2 diabetes (EXSCEL). New England Journal of Medicine 377:1228-1239. PMID 28910237. DOI 10.1056/NEJMoa1612917
- Ahmann AJ, Capehorn M, Charpentier G et al. (2018). Efficacy and safety of once-weekly semaglutide versus exenatide ER in subjects with type 2 diabetes (SUSTAIN 3): a 56-week, open-label, randomized clinical trial. Diabetes Care 41:258-266. PMID 29246950. DOI 10.2337/dc17-0417
- Vijiaratnam N, Girges C, Auld G et al. (2025). Exenatide once a week versus placebo as a potential disease-modifying treatment for people with Parkinson's disease in the UK (Exenatide-PD3): a phase 3, multicentre, double-blind, parallel-group, randomised, placebo-controlled trial. Lancet 405:627-636. PMID 39919773. DOI 10.1016/S0140-6736(24)02808-3
- AstraZeneca (2021). BYDUREON BCISE (exenatide extended-release) injectable suspension — US Prescribing Information, revision 07/2021 (NDA 209210, SUPPL-17). Boxed warning and sections 1, 4, 5.1-5.10, 6.1, 6.2, 12.3, 14.2 and 16. https://www.accessdata.fda.gov/drugsatfda_docs/label/2021/209210s017lbl.pdf
- U.S. Food and Drug Administration (2007). FDA Alert 10/2007 — information for healthcare professionals: exenatide (marketed as Byetta). Thirty post-marketing reports of acute pancreatitis, 27 of them with at least one further risk factor. Archived copy, https://web.archive.org/web/2008/http://www.fda.gov/cder/drug/InfoSheets/HCP/exenatide2008HCP.htm
- U.S. Food and Drug Administration (2008). Exenatide (marketed as Byetta) information, update of 18 August 2008 — six cases of haemorrhagic or necrotising pancreatitis, all admitted to hospital, two fatal. Archived copy, https://web.archive.org/web/20091101000000/http://www.fda.gov/Drugs/DrugSafety/PostmarketDrugSafetyInformationforPatientsandProviders/ucm113705.htm
- U.S. Food and Drug Administration (2009). MedWatch safety alert of 2 November 2009 — 78 cases of altered kidney function between April 2005 and October 2008, of which 62 acute renal failure and 16 renal insufficiency; labelling changed. Archived copy, https://web.archive.org/web/2010/http://www.fda.gov/Safety/MedWatch/SafetyInformation/SafetyAlertsforHumanMedicalProducts/ucm188703.htm
- Drugs@FDA via openFDA — active ingredient query EXENATIDE, returning five applications. ANDA 206697 (Amneal Pharmaceuticals) approved 19 November 2024, therapeutic equivalence code AP, listed as reference standard, marketing status prescription. https://api.fda.gov/drug/drugsfda.json?search=products.active_ingredients.name:%22EXENATIDE%22 — queried 10 September 2026
- Amneal Pharmaceuticals LLC (2026). EXENATIDE injection — DailyMed structured product label, setid e6cb5c8f-e97f-4a6a-95a4-939fd2393949, updated 27 May 2026; ANDA 206697, marketing start 22 November 2024, human prescription drug label. https://dailymed.nlm.nih.gov/dailymed/drugInfo.cfm?setid=e6cb5c8f-e97f-4a6a-95a4-939fd2393949
- Eng J, Kleinman WA, Singh L, Singh G, Raufman JP (1992). Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. Journal of Biological Chemistry 267:7402-7405. PMID 1313797. Published 15 April 1992
- National Center for Biotechnology Information. PubChem compound summary CID 45588096, exenatide — formula C184H282N50O60S, mass 4187, InChIKey HTQBXNHDCUEHJF-XWLPCZSASA-N, CAS 141758-74-9, UNII 9P1872D4OL, ATC A10BJ01, development codes AC2993, LY2148568 and PT302, one-letter sequence. https://pubchem.ncbi.nlm.nih.gov/compound/45588096 — queried 10 September 2026
- European Medicines Agency (2024). Byetta — Annex I, Summary of Product Characteristics. Sections 4.1, 4.2, 4.3, 4.4, 4.8 and 14. https://www.ema.europa.eu/en/documents/product-information/byetta-epar-product-information_en.pdf
- Federal Republic of Germany. Verordnung uber die Verschreibungspflicht von Arzneimitteln (AMVV), Anlage 1 — entry Exenatid, between Exemestan and Ezetimib. https://www.gesetze-im-internet.de/amvv/anlage_1.html
- Wikidata. Exenatide (Q417762) — DrugBank DB01276, ChEMBL CHEMBL414357, MeSH D000077270, ChEBI 64073, KEGG D04121, RxNorm 60548, ATC A10BJ01 and historically A10BX04. https://www.wikidata.org/wiki/Q417762 — queried 10 September 2026
- Buse JB, Rosenstock J, Sesti G et al. (2009). Liraglutide once a day versus exenatide twice a day for type 2 diabetes: a 26-week randomised, parallel-group, multinational, open-label trial (LEAD-6). Lancet 374:39-47. PMID 19515413. DOI 10.1016/S0140-6736(09)60659-0
- DeFronzo RA, Ratner RE, Han J et al. (2005). Effects of exenatide (exendin-4) on glycemic control and weight over 30 weeks in metformin-treated patients with type 2 diabetes (AMIGO-2). Diabetes Care 28:1092-1100. PMID 15855572. DOI 10.2337/diacare.28.5.1092
- Buse JB, Henry RR, Han J et al. (2004). Effects of exenatide (exendin-4) on glycemic control over 30 weeks in sulfonylurea-treated patients with type 2 diabetes (AMIGO-1). Diabetes Care 27:2628-2635. PMID 15504997. DOI 10.2337/diacare.27.11.2628
- Kendall DM, Riddle MC, Rosenstock J et al. (2005). Effects of exenatide (exendin-4) on glycemic control over 30 weeks in patients with type 2 diabetes treated with metformin and a sulfonylurea (AMIGO-3). Diabetes Care 28:1083-1091. PMID 15855571. DOI 10.2337/diacare.28.5.1083
- Drucker DJ, Buse JB, Taylor K et al. (2008). Exenatide once weekly versus twice daily for the treatment of type 2 diabetes: a randomised, open-label, non-inferiority study (DURATION-1). Lancet 372:1240-1250. PMID 18782641. DOI 10.1016/S0140-6736(08)61206-4
- ClinicalTrials.gov API v2. NCT00308139 (DURATION-1), sponsor AstraZeneca, phase 3, enrolment 303, completed, start April 2006. https://clinicaltrials.gov/api/v2/studies/NCT00308139 — queried 10 September 2026
- Buse JB, Nauck M, Forst T et al. (2013). Exenatide once weekly versus liraglutide once daily in patients with type 2 diabetes (DURATION-6): a randomised, open-label study. Lancet 381:117-124. PMID 23141817. DOI 10.1016/S0140-6736(12)61267-7
- Frias JP, Guja C, Hardy E et al. (2016). Exenatide once weekly plus dapagliflozin once daily versus exenatide or dapagliflozin alone in patients with type 2 diabetes inadequately controlled with metformin monotherapy (DURATION-8). Lancet Diabetes & Endocrinology 4:1004-1016. PMID 27651331. DOI 10.1016/S2213-8587(16)30267-4
- Athauda D, Maclagan K, Skene SS et al. (2017). Exenatide once weekly versus placebo in Parkinson's disease: a randomised, double-blind, placebo-controlled trial. Lancet 390:1664-1675. PMID 28781108. DOI 10.1016/S0140-6736(17)31585-4
- Su N, Li Y, Xu T et al. (2016). Exenatide in obese or overweight patients without diabetes: a systematic review and meta-analyses of randomized controlled trials. International Journal of Cardiology 219:293-300. PMID 27343423. DOI 10.1016/j.ijcard.2016.06.028
- Health Canada. Drug Product Database, drug product, status and schedule endpoints for drug codes 84685, 84686, 93433 and 97365 — DIN 02361809 cancelled post market 6 January 2022, DIN 02361817 cancelled post market 1 February 2022, DIN 02448610 cancelled post market 1 April 2022, DIN 02483203 cancelled pre market 30 May 2022; all prescription, sponsor AstraZeneca Canada Inc. https://health-products.canada.ca/api/drug/ — queried 10 September 2026
- Ashraf AR, Mackey TK, Vida RG et al. (2024). Multifactor quality and safety analysis of semaglutide products sold by online sellers without a prescription. Journal of Medical Internet Research 26:e65440. PMID 39509151. DOI 10.2196/65440. Cited here as context for the wider drug family; it does not concern exenatide
- European Medicines Agency (2024). Bydureon — Annex I, Summary of Product Characteristics. Sections 4.1, 4.2, 4.3, 4.4 and 5.1. https://www.ema.europa.eu/en/documents/product-information/bydureon-epar-product-information_en.pdf
- European Medicines Agency. Byetta — EPAR overview page. EMEA/H/C/000698, marketing authorisation issued 20 November 2006, revision 30, holder AstraZeneca AB, status authorised; page last updated 6 November 2024. https://www.ema.europa.eu/en/medicines/human/EPAR/byetta
- European Medicines Agency. Bydureon — EPAR overview page. EMEA/H/C/002020, marketing authorisation issued 17 June 2011, revision 27, status authorised; page last updated 21 November 2024. https://www.ema.europa.eu/en/medicines/human/EPAR/bydureon
- Drugs@FDA via openFDA — NDA 022200, approved 27 January 2012 as a type 3 new dosage form, marketing status discontinued. https://api.fda.gov/drug/drugsfda.json?search=application_number:NDA022200 — queried 10 September 2026
- Drugs@FDA via openFDA — NDA 209210, approved 20 October 2017 as a type 3 new dosage form, marketing status discontinued. https://api.fda.gov/drug/drugsfda.json?search=application_number:NDA209210 — queried 10 September 2026
- Pharmaceuticals and Medical Devices Agency (Japan). List of approved drugs, April 2004 to February 2026 — Byetta subcutaneous injection (Eli Lilly Japan K.K.), approved 27 October 2010, category 6-2; Bydureon for subcutaneous injection (Eli Lilly Japan K.K.), approved 30 March 2012, category 6-2
- Medicines and Healthcare products Regulatory Agency / Datapharm. Electronic medicines compendium — search for exenatide returned no results; control search for dulaglutide returned entries with the legal category prescription only medicine. https://www.medicines.org.uk/emc/search?q=exenatide — retrieved 10 September 2026
- Swissmedic. List of authorised packs for human medicines and the list with extended details — no result for exenatide, Byetta or Bydureon; control search returned liraglutide and several semaglutide packs. https://www.swissmedic.ch — data extracts evaluated September 2026
- Australian Government, Department of Health. Therapeutic Goods (Poisons Standard — June 2026) Instrument 2026, authorised version F2026L00633, registered 28 May 2026 — schedule 4, prescription only medicines: entry EXENATIDE, with no exemption
- openFDA drug shortages database — no match for exenatide (response: NOT_FOUND). https://api.fda.gov/drug/shortages.json?search=generic_name:%22exenatide%22 — queried 10 September 2026
- U.S. Food and Drug Administration. Bulk drug substances used in compounding under section 503A of the FD&C Act — no entry for exenatide or exendin. https://www.fda.gov/drugs/human-drug-compounding/bulk-drug-substances-used-compounding-under-section-503a-fdc-act — retrieved 10 September 2026
- U.S. Food and Drug Administration. Certain bulk drug substances for use in compounding may present significant safety risks — no entry for exenatide; control search returned entries for ipamorelin and BPC-157. https://www.fda.gov/drugs/human-drug-compounding/certain-bulk-drug-substances-use-compounding-may-present-significant-safety-risks — retrieved 10 September 2026
- World Anti-Doping Agency. The 2026 Prohibited List — World Anti-Doping Code. No occurrence of exenatide, exendin, Byetta or Bydureon in the full text; control hits in S2.3 (insulin-like growth factor 1 and its analogues) and S4.4.2 (insulins and insulin-mimetics)
- Federal Republic of Germany. Anlage (zu Paragraph 2 Absatz 3) of the Anti-Doping-Gesetz, BGBl. 2023 I Nr. 67, 1-5 — no entry for exenatide or exendin; control search returned tesamorelin and growth hormone entries. https://www.gesetze-im-internet.de/antidopg/anlage.html
- ClinicalTrials.gov API v2. Intervention queries for exenatide and for exendin-4, each returning 378 registered studies; a query for the sponsor Hudson Biotech with exenatide as intervention returned none. https://clinicaltrials.gov/api/v2/studies — queried 10 September 2026
Cite this page
The facts on this page were checked on 10 September 2026, and the register searches behind the status table were run on that date. Approved medicines gain new warnings and lose markets over time, so the version and the date matter as much as the text.
myPeptides Research & Editing. (2026). Exenatide: what the trials show, status and safety. Version 1.0, 10 September 2026. myPeptides Peptide Register. Retrieved from https://mypep.app/peptides/exenatide
How pages in this register are compiled and graded is described under methodology; the full register is at peptides.
| Version | Date | Change |
|---|---|---|
| 1.0 | 2026-09-10 | Initial publication |
Last verified: 10 September 2026. Next review: on a labelling change in any covered market, on any change to the American generic listing, or on any change in the anti-doping classification.