{"slug":"pnc-27","seoKey":"pnc27","displayName":"PNC-27","codes":["PNC-27","PNC27"],"synonyms":["PNC27","p53-derived membrane-resident peptide","p53 aa12-26-MRP","p53 (12-26)-penetratin","chimeric p53-penetratin peptide"],"legalClass":"research_chemical","identifiers":{"cas":"1159861-00-3","pubchemCid":16201774,"inchikey":"MZCACYLMMMXSKC-KOCFKOPYSA-N","formula":"C188H293N53O44S","molecularWeight":4032,"sequence":"PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG"},"approvals":[{"market":"US","status":"not_approved","date":"2017-03-27","note":"Not approved and never has been. Queries on 16 September 2026 returned no entry in the drug approval records, no product labelling and no enforcement record, while a control query for an approved medicine on the same endpoints returned results. No investigational application and no registered trial could be documented. The regulator instead issued a safety communication on 10 January 2017 warning cancer patients against using such products, stating it had never evaluated or approved the substance as safe and effective for any disease; an agency laboratory found Variovorax paradoxus in one inhalation preparation and, in an update on 27 March 2017, Ralstonia insidiosa in a second. That page now returns HTTP 404 and was read from the regulator's own web archive. The substance was never even nominated as a bulk substance for pharmacy compounding, so there is no lawful route to make it for human use.","source":"https://wayback.archive-it.org/7993/20190423141621/https://www.fda.gov/Drugs/DrugSafety/ucm536094.htm"},{"market":"EU","status":"not_approved","note":"No authorised medicine, no assessment report and no withdrawn-application record. The complete medicines list was downloaded and searched on 16 September 2026 for both spellings of the name and for the transport sequence with no match, while control terms in the same file were found several times. The interactive website search returned HTTP 401 on that date, so the negative finding rests on the medicines list rather than on the site search; an orphan designation without an authorisation might not appear in that list.","source":"https://www.ema.europa.eu/en/medicines"},{"market":"DE","status":"not_approved","note":"Not an authorised medicine. A substance with a medicinal purpose may not be placed on the market without an authorisation, and there is neither a central European authorisation nor a national finished medicine. Not listed in annexes I, II or III of the narcotics act, the full texts having been retrieved live and searched on 16 September 2026 with no match, while control terms in the same material were found dozens of times. No regulatory decision classifying the substance under the medicines act was found, and none is asserted here.","source":"https://www.gesetze-im-internet.de/amg_1976/__21.html"},{"market":"UK","status":"not_approved","note":"No authorised medicine and no product record. A direct query of the products register was not evaluable on 16 September 2026: the results page answers with HTTP 200 but contains only a loading placeholder and fetches its results by script, and a control query for an approved medicine returned the same empty shell. The negative finding therefore rests on the absence of any authorisation worldwide and on the fact that the substance never reached a registered clinical trial, not on a working register comparison.","source":"https://products.mhra.gov.uk/search/?search=PNC-27"},{"market":"AU","status":"not_approved","note":"Not named in the 2026 Poisons Standard; the full text was searched on 16 September 2026 for both spellings of the name and for the transport sequence with no match, while control terms in the same document were found. The absence of a listing does not make the substance freely available, since an injectable unlisted substance with a therapeutic purpose is not permitted goods without a register entry. A full-text query of the register of therapeutic goods was not possible on that date, the regulator site being unreachable.","source":"https://www.legislation.gov.au/F2026L00633/asmade"},{"market":"CA","status":"not_approved","note":"No authorised medicine. The drug product database returned an empty result for the active ingredient on 16 September 2026, while a control query on the same endpoint returned several entries, so the negative finding is verified.","source":"https://health-products.canada.ca/api/drug/activeingredient/?ingredientname=PNC-27"},{"market":"CH","status":"not_approved","note":"No authorisation. The index of authorised human medicine packages, dated 15 September 2026, was searched on 16 September 2026 for both spellings of the name and for the transport sequence with no match, while control product names in the same file returned numerous entries. That index lists products by brand name, so the control carries for brand names rather than for ingredient names; this is harmless here, because no brand name for the substance exists and an authorised product would necessarily be listed under some name.","source":"https://www.swissmedic.ch/"}],"devStage":"preclinical","strongestEvidence":"animal","wada":{"status":"prohibited","section":"S0","listYear":2026,"source":"https://www.wada-ama.org/en/prohibited-list"},"trials":[],"sameAs":["https://pubchem.ncbi.nlm.nih.gov/compound/16201774"],"lastVerified":"2026-09-16","version":"1.0","published":true,"locale":"en","title":"PNC-27: status, the FDA warning and what is unknown","summary":"PNC-27 is a laboratory peptide that joins a fragment of the human protein p53 to a positively charged transport sequence. It has never entered a registered clinical trial anywhere, in twenty-five years. In 2017 the American regulator warned against using it and found bacteria in two separate commercial samples. The one published human observation ended in a death whose cause remains open.","updated":"2026-09-16","url":"https://mypep.app/peptides/pnc-27"}